PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154880001
Common NameGSBRNA2T00154880001, LOC106389669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 295aa    MW: 32195.2 Da    PI: 6.6289
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154880001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-323791155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLHerFveav++LGG+ekAtPkt++++m+vkgLtl+h+kSHLQk+R 
  GSBRNA2T00154880001 37 KPRLRWTAELHERFVEAVTELGGPEKATPKTLMRTMGVKGLTLYHLKSHLQKFRQ 91
                         79****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-303491IPR009057Homeodomain-like
PROSITE profilePS5129410.8823494IPR017930Myb domain
SuperFamilySSF466892.69E-153691IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-223791IPR006447Myb domain, plants
PfamPF002496.4E-73989IPR001005SANT/Myb domain
PfamPF143791.4E-26136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MYSAIRSLPL DGGEYHGPLD GTNLPGDACL VLTTDPKPRL RWTAELHERF VEAVTELGGP  60
EKATPKTLMR TMGVKGLTLY HLKSHLQKFR QGRQACKEST DNSNKDASCV GESQDTGSSS  120
PSSLKLAAQE QNESYQVTEA LRAQMEVQRR LHEQLEVQRR LQVRIEAQGK YLQSILEKAC  180
KAFEEQAAMF TGLETAREEL SELAIKVSNS SQGATVPYFD ATKMMMMMPS LSELEVAAID  240
HKSNITTTNC SVESSLTSNT NGSSVSAASM KKRHRGGDNV GYEGSWTVPS STIG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.7680.0flower| leaf| microspore-derived embryo| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154880001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135873.10.0PREDICTED: myb family transcription factor APL-like isoform X2
RefseqXP_013685443.10.0PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK58e-64APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078DX320.0A0A078DX32_BRANA; BnaA03g37160D protein
TrEMBLM4CCJ70.0M4CCJ7_BRARP; Uncharacterized protein
STRINGBra001927.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-179G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]